database / hormone
Teriparatide
also known as PTH (1-34), Forteo
Skeletal structure drawn from the computed atomic coordinates in PubChem CID 16133850. Carbons are implicit vertices, hydrogens on carbon suppressed. Every atom sits where PubChem placed it.
Sequence
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe
- hydrophobic
- positive
- negative
- polar
- aromatic
- glycine
- proline
- cysteine
Computed backbone mass 4117.76 Da agrees with PubChem's reported 4118 Da (Δ 0.24 Da). Two independent sources agree on the primary structure.
Molecular data
| molecular formula | C181H291N55O51S2 |
|---|---|
| molecular weight | 4118 Da (PubChem) |
| computed backbone mass | 4117.76 Da |
| length | 34 residues |
| net charge (pH 7.4) | +1 |
| mean hydropathy | -0.67 |
| half-life | not characterised |
| delivery route | subcutaneous |
| PubChem CID | 16133850 |
| PDB | not characterised |
| UniProt parent | P01270 |
Mechanism
PTH1R agonist; intermittent exposure drives bone formation.
Reported targets: PTH1R
Experimental structure
No experimental structure deposited in the PDB. A predicted fold is not a structure, so nothing is drawn.
Helical wheel
Residues projected at 100° per turn, the standard α-helix rotation. Shown because helicity in this peptide is described in the cited literature.
Position in the parent protein
…AKVMIVMLAICFLTKSDGKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNV…
Parent sequence from UniProt P01270. Residues 1-34 of human PTH.
Reported effects
Each row is an outcome described in the literature indexed for this peptide.
| reported outcome | where it appears |
|---|---|
| bone mineral density outcomes in trials | Mechanisms limiting the long-term anabolic effects of teriparatide (PTH 1-34… JBMR plus 2026 |
| fracture-risk outcomes in trials | Teriparatide Therapy in Children with Hypoparathyroidism: A Systematic Revie… Calcified tissue international 2026 |
Registered trials
| NCT | title | status | phase |
|---|---|---|---|
| NCT04974723 | Real-world Effectiveness and Cardiovascular Safety Study of Abaloparatide in Postmenopausal | COMPLETED | — |
| NCT01078805 | Study of FORTEO Use in Subjects in the Community Setting | COMPLETED | — |
| NCT04126941 | Monocentric Study on the Use of Teriparatide in Children With hypoparathyroïdism | UNKNOWN | — |
| NCT00361595 | Intervenous (IV) Zoledronic Acid After Forteo in Postmenopausal Women | COMPLETED | NA |
| NCT02091492 | Teriparatide for Fracture Repair in Humans | WITHDRAWN | PHASE3 |
Literature (8)
Mechanisms limiting the long-term anabolic effects of teriparatide (PTH 1-34) on bone — JBMR plus 2026
Teriparatide, (recombinant human PTH 1-34) is an Food and Drug Administration (FDA)-approved anabolic therapy for osteoporosis. In patients with severe bone loss, daily teriparatide injections increase osteoblastic activity and bone turnover, leading to net gain in bone mass, increased BMD, and significantly reduced fracture risk. However, after 6-12 mo of treatment, its anabolic effects, reflected by increased serum bone turnover markers and LS-BMD gain, tend to diminish. Despite various efforts to address this challenge, the underlying mechanisms have remained poorly understood. This review discusses the main mechanisms proposed to limit teriparatide's bone anabolic potential, including osteoprogenitor depletion, changes in bone remodeling dynamics, counter-regulatory molecules (eg, Wnt inhibitors), the influence of mechanical loading, and downstream signaling adaptations. Understandin…
open access ↗ · PMID 42306552 · DOI 10.1093/jbmrpl/ziag093
Teriparatide Therapy in Children with Hypoparathyroidism: A Systematic Review and Meta-Analysis — Calcified tissue international 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42501079 · DOI 10.1007/s00223-026-01582-y
Nutritional activation of the Nrf2-Pth1r axis by pyrroloquinoline quinone enhances peak bone mass and potentiates teriparatide in osteoporosis — Free radical biology & medicine 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 41687747 · DOI 10.1016/j.freeradbiomed.2026.02.026
Biochemical and clinical outcomes of once-daily teriparatide in refractory chronic hypoparathyroidism: A single-center experience — Northern clinics of Istanbul 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42516799 · DOI 10.14744/nci.2026.03780
Smart polymersome carriers for osteoporosis treatment: Enhanced bone regeneration via targeted teriparatide delivery — Nanomedicine : nanotechnology, biology, and medicine 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 41421791 · DOI 10.1016/j.nano.2025.102891
SAT-804 Comparison of Forteo and Teriparatide on Improvements in Bone Mineral Density — Journal of the Endocrine Society 2025
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
Synergistic effects of intermittent parathyroid hormone (1-34) and masticatory force for alveolar bone remodeling in the maxilla of dogs — Journal of stomatology, oral and maxillofacial surgery 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42176894 · DOI 10.1016/j.jormas.2026.102850
Potent and biased agonists of class B1 GPCRs from a heterochiral design strategy — Nature chemistry 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42303736 · DOI 10.1038/s41557-026-02182-x
The mechanism, illustrated
Related
Glucagon
hormone · 8 citations
Ghrelin
hormone · 8 citations
Oxytocin
hormone · 8 citations
Vasopressin
hormone · 8 citations
Gonadorelin
hormone · 8 citations
Kisspeptin-10
hormone · 8 citations