biohacking$bioLLM CA: TBA

database / hormone

Glucagon

approved hormone metabolicendocrine mass-verified
SOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
246 heavy atoms · 477 bonds · drag to pan, scroll to zoom C153O49N43S1

Skeletal structure drawn from the computed atomic coordinates in PubChem CID 16132283. Carbons are implicit vertices, hydrogens on carbon suppressed. Every atom sits where PubChem placed it.

Sequence

HSQGTFTSDYSKYLDSRRAQDFVQWLMNT

His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr

1. His — Histidine · positive · hydropathy -3.2 · charge 0H12. Ser — Serine · polar · hydropathy -0.8 · charge 0S3. Gln — Glutamine · polar · hydropathy -3.5 · charge 0Q4. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G5. Thr — Threonine · polar · hydropathy -0.7 · charge 0T6. Phe — Phenylalanine · aromatic · hydropathy 2.8 · charge 0F67. Thr — Threonine · polar · hydropathy -0.7 · charge 0T8. Ser — Serine · polar · hydropathy -0.8 · charge 0S9. Asp — Aspartic acid · negative · hydropathy -3.5 · charge −1D10. Tyr — Tyrosine · aromatic · hydropathy -1.3 · charge 0Y11. Ser — Serine · polar · hydropathy -0.8 · charge 0S1112. Lys — Lysine · positive · hydropathy -3.9 · charge +1K13. Tyr — Tyrosine · aromatic · hydropathy -1.3 · charge 0Y14. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L15. Asp — Aspartic acid · negative · hydropathy -3.5 · charge −1D16. Ser — Serine · polar · hydropathy -0.8 · charge 0S1617. Arg — Arginine · positive · hydropathy -4.5 · charge +1R18. Arg — Arginine · positive · hydropathy -4.5 · charge +1R19. Ala — Alanine · hydrophobic · hydropathy 1.8 · charge 0A20. Gln — Glutamine · polar · hydropathy -3.5 · charge 0Q21. Asp — Aspartic acid · negative · hydropathy -3.5 · charge −1D2122. Phe — Phenylalanine · aromatic · hydropathy 2.8 · charge 0F23. Val — Valine · hydrophobic · hydropathy 4.2 · charge 0V24. Gln — Glutamine · polar · hydropathy -3.5 · charge 0Q25. Trp — Tryptophan · aromatic · hydropathy -0.9 · charge 0W26. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L2627. Met — Methionine · hydrophobic · hydropathy 1.9 · charge 0M28. Asn — Asparagine · polar · hydropathy -3.5 · charge 0N29. Thr — Threonine · polar · hydropathy -0.7 · charge 0T29

Computed backbone mass 3482.79 Da agrees with PubChem's reported 3482.7 Da (Δ 0.09 Da). Two independent sources agree on the primary structure.

Molecular data

Chemical fields come from the PubChem compound record; computed values are derived from the sequence shown above.
molecular formulaC153H225N43O49S
molecular weight3482.7 Da (PubChem)
computed backbone mass3482.79 Da
length29 residues
net charge (pH 7.4)0
mean hydropathy-0.99
half-lifenot characterised
delivery routesubcutaneous, intramuscular, intranasal
PubChem CID16132283
PDB1GCN
UniProt parentP01275

Mechanism

Glucagon receptor agonist; raises hepatic glucose output.

Reported targets: GCGR

Experimental structure

α-carbon backbone trace rendered from the deposited coordinates of PDB 1GCN. This is measured structure, not a prediction.

Helical wheel

1. His — Histidine · positiveH2. Ser — Serine · polarS3. Gln — Glutamine · polarQ4. Gly — Glycine · glycineG5. Thr — Threonine · polarT6. Phe — Phenylalanine · aromaticF7. Thr — Threonine · polarT8. Ser — Serine · polarS9. Asp — Aspartic acid · negativeD10. Tyr — Tyrosine · aromaticY11. Ser — Serine · polarS12. Lys — Lysine · positiveK13. Tyr — Tyrosine · aromaticY14. Leu — Leucine · hydrophobicL15. Asp — Aspartic acid · negativeD16. Ser — Serine · polarS17. Arg — Arginine · positiveR18. Arg — Arginine · positiveR

Residues projected at 100° per turn, the standard α-helix rotation. Shown because helicity in this peptide is described in the cited literature.

Position in the parent protein

exact match at residues 53–81 of Pro-glucagon (180 aa)

…KSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTS…

Parent sequence from UniProt P01275. Cleaved from proglucagon, which also yields GLP-1 and GLP-2.

Reported effects

Each row is an outcome described in the literature indexed for this peptide.

Reported observations and the corpus they are drawn from.
reported outcomewhere it appears
glucose elevationLower glucagon response and attenuated hepatic glucagon signaling in MASLD Diabetes & metabolism 2026
energy expenditureStathmin-2 mediates paracrine hormone regulation of glucagon through lysosom… The Journal of physiology 2026

Registered trials

Records from ClinicalTrials.gov. Listed for reference — this project sponsors no trial and is not involved in any of them.
NCTtitlestatusphase
NCT07487090Fasted vs. Fed State ExerciseRECRUITINGPHASE2
NCT03200782Postprandial Hypoglycemia in Patients After Bariatric Surgery With Empagliflozin and AnakinrCOMPLETEDNA
NCT02280174Effect of Linagliptin on TRL MetabolismUNKNOWNPHASE4
NCT03230123Effects of Green Banana BIOmass Consumption in Patients With Pre-diabetes and Diabetes MELliUNKNOWNNA
NCT04260035The Effects of a Long-lasting Infusion of Vasoactive Intestinal Peptide (VIP) in Episodic MiCOMPLETEDNA

Literature (8)

Lower glucagon response and attenuated hepatic glucagon signaling in MASLD — Diabetes & metabolism 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42580550 · DOI 10.1016/j.diabet.2026.101787

Stathmin-2 mediates paracrine hormone regulation of glucagon through lysosomal trafficking in αTC1-6 cells — The Journal of physiology 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42625306 · DOI 10.1113/jp291537

Role of glucagon in metabolic diseases — Journal of diabetes investigation 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42593182 · DOI 10.1111/jdi.70416

Amylin Coexisting With Peptide YY (PYY) and Amylin/PYY Cells Correspond to Subpopulations of Glucagon- and Glucagon-Like Peptide-1-Immunoreactive Cells in the Japanese Eel (Anguilla japonica) Pancreas — Anatomia, histologia, embryologia 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42559671 · DOI 10.1111/ahe.70161

Early loss and progressive deterioration of glucagon responses to hypoglycemia in children with type 1 diabetes — BMJ open diabetes research & care 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42648789 · DOI 10.1136/bmjdrc-2026-005959

Conformational determinants of glucagon stability and aggregation kinetics in aqueous and commercial formulations — Protein science : a publication of the Protein Society 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42557738 · DOI 10.1002/pro.70750

Effects of Glucagon-Like Peptide 1, Glucagon, and Glucose-Dependent Insulinotropic Polypeptide on Fluid Secretion in Guinea-Pig Pancreatic Duct Cells — Pancreas 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42081276 · DOI 10.1097/mpa.0000000000002661

Acute glucagon infusion induces natriuresis and diuresis through a direct tubular mechanism involving overlapping receptor pathways — American journal of physiology. Renal physiology 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42568245 · DOI 10.1152/ajprenal.00195.2026

The mechanism, illustrated

Not memed yet.

33 of the 100 indexed peptides have one. See which →

Related

Retatrutide

incretin · 8 citations

Ghrelin

hormone · 8 citations

Oxytocin

hormone · 8 citations

Vasopressin

hormone · 8 citations

Gonadorelin

hormone · 8 citations

Kisspeptin-10

hormone · 8 citations