biohacking$bioLLM CA: TBA

database / immune

KPV

also known as α-MSH (11-13), KPV tripeptide, lysine-proline-valine

preclinical immune immunegastrointestinalintegumentary mass-verified
OOOONNNNHHHHHH
24 heavy atoms · 54 bonds · drag to pan, scroll to zoom C16O4N4

Skeletal structure drawn from the computed atomic coordinates in PubChem CID 125672. Carbons are implicit vertices, hydrogens on carbon suppressed. Every atom sits where PubChem placed it.

Sequence

KPV

Lys-Pro-Val

1. Lys — Lysine · positive · hydropathy -3.9 · charge +1K12. Pro — Proline · proline · hydropathy -1.6 · charge 0P3. Val — Valine · hydrophobic · hydropathy 4.2 · charge 0V3

Computed backbone mass 342.44 Da agrees with PubChem's reported 342.43 Da (Δ 0.01 Da). Two independent sources agree on the primary structure.

Molecular data

Chemical fields come from the PubChem compound record; computed values are derived from the sequence shown above.
molecular formulaC16H30N4O4
molecular weight342.43 Da (PubChem)
computed backbone mass342.44 Da
length3 residues
net charge (pH 7.4)+1
mean hydropathy-0.43
half-lifenot characterised
delivery routenot characterised
PubChem CID125672
PDBnot characterised
UniProt parentP01189

Mechanism

C-terminal tripeptide of α-MSH; studied for anti-inflammatory activity independent of pigmentation effects.

Reported targets: melanocortin pathway

Experimental structure

No experimental structure deposited in the PDB. A predicted fold is not a structure, so nothing is drawn.

Position in the parent protein

exact match at residues 148–150 of Pro-opiomelanocortin (267 aa)

…RSDGAKPGPREGKRSYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPL…

Parent sequence from UniProt P01189. KPV is the C-terminal tripeptide of α-MSH, itself a POMC product.

Reported effects

Each row is an outcome described in the literature indexed for this peptide.

Reported observations and the corpus they are drawn from.
reported outcomewhere it appears
anti-inflammatory activityLysine-proline-valine peptide attenuates hepatic lipid accumulation through … Cytotechnology 2026
intestinal inflammation reductionKPV attenuates adipogenesis and lipid metabolism through modulation of ROS-m… Tissue & cell 2026

Literature (8)

Lysine-proline-valine peptide attenuates hepatic lipid accumulation through ROS-dependent regulation of the PPARγ pathway in HepG2 cells — Cytotechnology 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42064835 · DOI 10.1007/s10616-026-00967-z

KPV attenuates adipogenesis and lipid metabolism through modulation of ROS-mediated AKT/mTORC1/PPARγ signaling — Tissue & cell 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42585803 · DOI 10.1016/j.tice.2026.103837

Lysine-Proline-Valine peptide mitigates fine dust-induced keratinocyte apoptosis and inflammation by regulating oxidative stress and modulating the MAPK/NF-κB pathway — Tissue & cell 2025

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 40073467 · DOI 10.1016/j.tice.2025.102837

NLRP3 autophagic degradation disruption in melanocytes contributes to vitiligo development — Cell death and differentiation 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 40935835 · DOI 10.1038/s41418-025-01578-5

KPV and RAPA Self-Assembled into Carrier-Free Nanodrugs for Vascular Calcification Therapy — Advanced healthcare materials 2024

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 39252648 · DOI 10.1002/adhm.202402320

Correlative evaluation of anticancer effects of a modified methioninase MGL-KPV using 2D and 3D cell models, human cancer xenografts in zebrafish embryos and Balb/c nude mice — bioRxiv 2025

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · DOI 10.64898/2025.12.23.696173

Inflammation-triggered self-immolative conjugates enable oral peptide delivery by overcoming gastrointestinal barriers — Science advances 2026

Oral delivery of peptide therapeutics remains challenging due to gastrointestinal (GI) degradation and poor intestinal absorption. Here, we propose a self-immolative peptide prodrug conjugate (SIPPC) platform for inflammation-targeted oral delivery, integrating a hydrophilic polyethylene glycol segment, a reactive oxygen species (ROS)-responsive hydrophobic self-immolative module, and a hydrolyzable scaffold, which collectively enable spontaneous assembly into micelle-like nanoparticles. Using three anti-inflammatory peptides (KPV, Ac-QAW, and IRW), we demonstrated that the engineered conjugates exhibit remarkable GI stability, efficient mucus penetration, and ROS-responsive release at inflamed sites. In colitis mice, the KPV-based conjugate (proKPV) achieved a 3.8-fold greater colonic accumulation than free KPV, with enhanced efficacy even at a 20-fold lower dose. Beyond therapeutic eff…

open access ↗ · PMID 41533788 · DOI 10.1126/sciadv.aea2989

A PepT1 mediated medicinal nano-system for targeted delivery of cyclosporine A to alleviate acute severe ulcerative colitis — Biomaterials science 2019

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 31408067 · DOI 10.1039/c9bm00925f

The mechanism, illustrated

Not memed yet.

33 of the 100 indexed peptides have one. See which →

Related

Semax

nootropic · 8 citations

Tuftsin

immune · 8 citations

Thymosin α1

immune · 8 citations

LL-37

immune · 8 citations

Human β-defensin 2

immune · 8 citations

Thymulin

immune · 8 citations