biohacking$bioLLM CA: TBA

database / immune

Human β-defensin 2

also known as hBD-2, DEFB4A

preclinical immune immuneintegumentaryrespiratory modified — mass check n/a

Sequence

GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP

Gly-Ile-Gly-Asp-Pro-Val-Thr-Cys-Leu-Lys-Ser-Gly-Ala-Ile-Cys-His-Pro-Val-Phe-Cys-Pro-Arg-Arg-Tyr-Lys-Gln-Ile-Gly-Thr-Cys-Gly-Leu-Pro-Gly-Thr-Lys-Cys-Cys-Lys-Lys-Pro

1. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G12. Ile — Isoleucine · hydrophobic · hydropathy 4.5 · charge 0I3. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G4. Asp — Aspartic acid · negative · hydropathy -3.5 · charge −1D5. Pro — Proline · proline · hydropathy -1.6 · charge 0P6. Val — Valine · hydrophobic · hydropathy 4.2 · charge 0V67. Thr — Threonine · polar · hydropathy -0.7 · charge 0T8. Cys — Cysteine · cysteine · hydropathy 2.5 · charge 0C9. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L10. Lys — Lysine · positive · hydropathy -3.9 · charge +1K11. Ser — Serine · polar · hydropathy -0.8 · charge 0S1112. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G13. Ala — Alanine · hydrophobic · hydropathy 1.8 · charge 0A14. Ile — Isoleucine · hydrophobic · hydropathy 4.5 · charge 0I15. Cys — Cysteine · cysteine · hydropathy 2.5 · charge 0C16. His — Histidine · positive · hydropathy -3.2 · charge 0H1617. Pro — Proline · proline · hydropathy -1.6 · charge 0P18. Val — Valine · hydrophobic · hydropathy 4.2 · charge 0V19. Phe — Phenylalanine · aromatic · hydropathy 2.8 · charge 0F20. Cys — Cysteine · cysteine · hydropathy 2.5 · charge 0C21. Pro — Proline · proline · hydropathy -1.6 · charge 0P2122. Arg — Arginine · positive · hydropathy -4.5 · charge +1R23. Arg — Arginine · positive · hydropathy -4.5 · charge +1R24. Tyr — Tyrosine · aromatic · hydropathy -1.3 · charge 0Y25. Lys — Lysine · positive · hydropathy -3.9 · charge +1K26. Gln — Glutamine · polar · hydropathy -3.5 · charge 0Q2627. Ile — Isoleucine · hydrophobic · hydropathy 4.5 · charge 0I28. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G29. Thr — Threonine · polar · hydropathy -0.7 · charge 0T30. Cys — Cysteine · cysteine · hydropathy 2.5 · charge 0C31. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G3132. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L33. Pro — Proline · proline · hydropathy -1.6 · charge 0P34. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G35. Thr — Threonine · polar · hydropathy -0.7 · charge 0T36. Lys — Lysine · positive · hydropathy -3.9 · charge +1K3637. Cys — Cysteine · cysteine · hydropathy 2.5 · charge 0C38. Cys — Cysteine · cysteine · hydropathy 2.5 · charge 0C39. Lys — Lysine · positive · hydropathy -3.9 · charge +1K40. Lys — Lysine · positive · hydropathy -3.9 · charge +1K41. Pro — Proline · proline · hydropathy -1.6 · charge 0P41

Modified molecule. Contains three intramolecular disulfide bonds that define the defensin fold.

Backbone carries modifications, so computed backbone mass is not comparable to the reported mass of the complete molecule.

Molecular data

Chemical fields come from the PubChem compound record; computed values are derived from the sequence shown above.
molecular formulanot characterised
molecular weight4334.24 Da (computed from sequence)
computed backbone mass4334.24 Da
length41 residues
net charge (pH 7.4)+6
mean hydropathy-0.1
half-lifenot characterised
delivery routenot characterised
PubChem CIDnot characterised
PDB1FD3
UniProt parentO15263

Mechanism

Inducible epithelial antimicrobial peptide; also a CCR6 chemoattractant.

Reported targets: microbial membranes CCR6

Experimental structure

α-carbon backbone trace rendered from the deposited coordinates of PDB 1FD3. This is measured structure, not a prediction.

Position in the parent protein

exact match at residues 24–64 of Defensin beta 4A (64 aa)

MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP

Parent sequence from UniProt O15263. Mature peptide of the hBD-2 precursor.

Reported effects

Each row is an outcome described in the literature indexed for this peptide.

Reported observations and the corpus they are drawn from.
reported outcomewhere it appears
antimicrobial activityHuman Beta-Defensin 2 in Children with IgA Vasculitis: A Potential Link Betw… Research Square 2026
chemotaxisInvestigating the role of serum human beta defensin-2 in psoriasis and psori… Cutaneous and ocular toxicology 2026

Literature (8)

Human Beta-Defensin 2 in Children with IgA Vasculitis: A Potential Link Between Innate Immunity and Vascular Inflammation — Research Square 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · DOI 10.21203/rs.3.rs-8883108/v1

Investigating the role of serum human beta defensin-2 in psoriasis and psoriatic arthritis: a case-control study on hBD-2 and CRP, ESR — Cutaneous and ocular toxicology 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 41689371 · DOI 10.1080/15569527.2026.2630770

Sodium hyaluronate fragments promote the expression of human beta-defensin 2 in the skin to alleviate Staphylococcus aureus infection — Research Square 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · DOI 10.21203/rs.3.rs-8437901/v1

Human beta defensin-2 protects the epithelial barrier during methicillin-resistant <i>Staphylococcus aureus</i> infection in chronic rhinosinusitis with nasal polyps — Frontiers in cellular and infection microbiology 2025

ObjectiveWe investigated the effect of human beta defensin-2 (hBD-2) on nasal epithelial barrier function with methicillin-resistant Staphylococcus aureus (MRSA) infection in chronic rhinosinusitis with nasal polyps (CRSwNP).MethodsThe expression of hBD-2 was measured in nasal polyps (NPs) from CRSwNP. MRSA was treated with different concentrations of hBD-2 to assess the invasive ability. Primary human nasal epithelial cells (HNECs) cultured at the air-liquid interface (ALI) were pre-incubated with or without hBD-2 prior to MRSA infection. The cell viability, the epithelial cell integrity, and the tight junction (TJ) expression were evaluated.ResultsThe expression of hBD-2 in the CRSwNP group was higher than that in the control group. In addition, the hBD-2 protein was negatively correlated with the Lund-Mackay CT score and was positively correlated with the neutrophil levels in CRSwNP. …

open access ↗ · PMID 40415954 · DOI 10.3389/fcimb.2025.1551080

Circulating Antimicrobial Peptides as Biomarkers of Inflammation and Airway Dysfunction After Marathon Running — Biology 2025

Marathon running exerts physical stress and may lead to transient immune dysregulation, increasing susceptibility to airway inflammation and exercise-induced bronchoconstriction (EIB). This study investigated systemic levels of antimicrobial peptides in athletes and their association with EIB. Serum concentrations of angiogenin, human beta-defensin 2 (hBD-2), major basic protein (MBP), S100A8, and S100A8/A9 were measured in 34 marathoners and 36 half-marathoners at baseline, immediately after a race, and seven days postrace using enzyme-linked immunosorbent assays and compared with 30 sedentary controls. Lung function was assessed by spirometry to identify bronchoconstriction. Levels of hBD-2 and S100A8/A9 were significantly elevated postrace in runners compared to baseline and controls, returning to baseline during recovery. During recovery, S100A8 levels remained slightly elevated in m…

open access ↗ · PMID 40723384 · DOI 10.3390/biology14070825

Circulating Antimicrobial Peptides as Biomarkers of Inflammation and Airway Dysfunction After Marathon Running — Preprints.org 2025

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · DOI 10.20944/preprints202505.1726.v1

Assessment of IL-6, IL-33, and hBD2 and their correlations with cardiovascular risk in Systemic Lupus Erythematous patients — Research Square 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · DOI 10.21203/rs.3.rs-8766282/v1

New Postbiotic Derived from Sequential Fermentation of Two <i>Lacticaseibacillus</i> Strains Exerts Beneficial Effects on Epithelial Gut Barrier and Innate Immunity in Human Enterocytes — Microorganisms 2026

The efficacy of postbiotics varies significantly between different strains and preparation processes. We aimed at evaluating the effect of an innovative postbiotic product (iPB) generated through the sequential fermentation of Lacticaseibacillus rhamnosus GG and Lacticaseibacillus paracasei NPB-01, compared to single-strain postbiotics, on epithelial barrier integrity and innate immunity in human enterocytes using a Caco-2-cell-based experimental model by measuring human enterocyte proliferation and differentiation (lactase expression), tight junction proteins (occludin and zonula occludens 1, ZO-1), and mucus protein Mucin-2 (Muc-2) expression. The modulatory action on the major innate immunity peptide, Human Beta-Defensin 2 (HBD-2), production was also assessed. The iPB exposure resulted in a higher up-regulation of human enterocyte proliferation and differentiation, as suggested by hi…

open access ↗ · PMID 42075327 · DOI 10.3390/microorganisms14040931

The mechanism, illustrated

Not memed yet.

33 of the 100 indexed peptides have one. See which →

Related

KPV

immune · 8 citations

Tuftsin

immune · 8 citations

Thymosin α1

immune · 8 citations

LL-37

immune · 8 citations

Thymulin

immune · 8 citations

Melittin

immune · 8 citations