database / incretin
GIP
also known as glucose-dependent insulinotropic polypeptide
Sequence
YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln
- hydrophobic
- positive
- negative
- polar
- aromatic
- glycine
- proline
- cysteine
No independent molecular weight was available to check the sequence against.
Molecular data
| molecular formula | not characterised |
|---|---|
| molecular weight | 4983.59 Da (computed from sequence) |
| computed backbone mass | 4983.59 Da |
| length | 42 residues |
| net charge (pH 7.4) | 0 |
| mean hydropathy | -0.8 |
| half-life | not characterised |
| delivery route | not characterised |
| PubChem CID | not characterised |
| PDB | not characterised |
| UniProt parent | P09681 |
Mechanism
Incretin hormone acting at the GIP receptor.
Reported targets: GIPR
Experimental structure
No experimental structure deposited in the PDB. A predicted fold is not a structure, so nothing is drawn.
Position in the parent protein
…FSALPSLPVGSHAKVSSPQPRGPRYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQREARALELASQANRKEEEAVEPQS…
Parent sequence from UniProt P09681. Processed from the GIP precursor.
Reported effects
Each row is an outcome described in the literature indexed for this peptide.
| reported outcome | where it appears |
|---|---|
| insulin secretion | Recent advances in incretin biology and therapeutics: From glucose-dependent… Journal of diabetes investigation 2026 |
| adipose metabolism | Glucagon-like peptide-1 (GLP-1) and dual glucose-dependent insulinotropic po… Clinical and experimental dermatology 2026 |
Literature (8)
Recent advances in incretin biology and therapeutics: From glucose-dependent insulinotropic polypeptide reappraisal to next-generation agonists — Journal of diabetes investigation 2026
Future directions in incretin research: Three major directions currently shape therapeutic innovation in incretin research: multi-receptor agonism, oral drug development, and mechanistic reappraisal of glucose-dependent insulinotropic polypeptide (GIP) physiology. These advances indicate that incretin-based therapies should be understood within an integrated enteroinsular network rather than through isolated hormone actions. DPP-4, dipeptidyl peptidase-4; GCGR, glucagon receptor; GIPR, GIP receptor; GLP-1, glucagon-like peptide-1; GLP-1R, GLP-1 receptor; T2D, type 2 diabetes.
open access ↗ · PMID 41928613 · DOI 10.1111/jdi.70299
Glucagon-like peptide-1 (GLP-1) and dual glucose-dependent insulinotropic polypeptide/GLP-1 receptor agonists in dermatology: only one piece of the puzzle — Clinical and experimental dermatology 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 41703789 · DOI 10.1093/ced/llag091
Dysfunctional Lipid-Induced Secretion of Glucagon-Like Peptide-2(GLP-2), but Not of Incretins Glucagon-Like Peptide-1(GLP-1)/Glucose-Dependent Insulinotropic Polypeptide(GIP), Promotes Metabolic Dysfunction-Associated Steatotic Liver Disease (MASLD) Onset and Progression Through Gut Barrier Disruption and Endotoxemia — MedComm 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
open access ↗ · PMID 41948456 · DOI 10.1002/mco2.70323
Correction to: "Glucose-Dependent Insulinotropic Polypeptide in Incretin Physiology: Role in Health and Disease" — Endocrine reviews 2025
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
open access ↗ · PMID 40833798 · DOI 10.1210/endrev/bnaf028
Glucose-dependent insulinotropic polypeptide (GIP) — Trends in endocrinology and metabolism: TEM 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 41547649 · DOI 10.1016/j.tem.2025.12.002
Exercise-induced anaphylaxis with a cofactor of GIP/GLP-1 receptor agonist: A case report — The journal of allergy and clinical immunology. Global 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42405354 · DOI 10.1016/j.jacig.2026.100751
Glucose-Dependent Insulinotropic Polypeptide Receptors Are Expressed in the Lateral Septum and Reduce Electrically-Evoked Dopamine Release as well as the Ability of Cocaine to Increase Extracellular Dopamine — ACS chemical neuroscience 2026
Tirzepatide, a dual agonist of the glucagon-like peptide 1 receptor (GLP-1R) and glucose-dependent insulinotropic polypeptide receptor (GIPR), represents a new class of medication for obesity and type II diabetes treatment. Using laboratory mice, we show that GIPRs are present in the lateral septum (LS) in cells also expressing GLP-1R, particularly in the dorsolateral LS. Likewise, we show the coexpression of the dopamine (DA) D2 receptor (DRD2) in LS cells with GLP-1R in both the dorsolateral and intermediate portions of the LS. Using fast-scan cyclic voltammetry, we demonstrate that systemic GLP-1R or GIPR agonist treatment reduces both electrically evoked DA release in the LS and the ability of cocaine to increase extracellular DA levels. These data unveil a new central role for GIPR signaling and identify a potentially important cell type expressing both GLP-1R and GIPR upon which ti…
open access ↗ · PMID 42219687 · DOI 10.1021/acschemneuro.5c00954
Glucagon-like peptide-1 agonists usage to widen the living donor pool for liver transplantation: A novel metabolic strategy — World journal of transplantation 2026
Glucagon-like peptide-1 (GLP-1)/glucose-dependent insulinotropic polypeptide receptor agonists' use as a weight loss tool is gradually expanding. They can be used as bridging therapies to reduce weight in potential living donors for liver transplantation and improve graft quality. A living donor with high body mass index is likely to be declined in most living donor programs due to concerns about donor safety and graft function. Reducing weight before surgical procedures can improve outcomes and lower the incidence of morbidity and mortality. Growing clinical evidence supports the advantage of GLP-1 receptor agonists as well as GLP-1/glucose-dependent insulinotropic polypeptide receptor agonists as bridging therapies to minimize perioperative complications. However, these agents should be used with caution due to concerns about side effects, particularly delayed gastric emptying and the …
open access ↗ · PMID 42281856 · DOI 10.5500/wjt.v16.i2.118702
The mechanism, illustrated
Not memed yet.
33 of the 100 indexed peptides have one. See which →
Related
Semaglutide
incretin · 8 citations
Tirzepatide
incretin · 8 citations
Retatrutide
incretin · 8 citations
Liraglutide
incretin · 8 citations
Exenatide
incretin · 8 citations
GLP-1 (7-37)
incretin · 8 citations