database / incretin
Exenatide
also known as Byetta, exendin-4
Skeletal structure drawn from the computed atomic coordinates in PubChem CID 45588096. Carbons are implicit vertices, hydrogens on carbon suppressed. Every atom sits where PubChem placed it.
Sequence
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser
- hydrophobic
- positive
- negative
- polar
- aromatic
- glycine
- proline
- cysteine
Modified molecule. C-terminal amide. Synthetic version of exendin-4, originally characterised from Heloderma suspectum venom.
Backbone carries modifications, so computed backbone mass is not comparable to the reported mass of the complete molecule.
Molecular data
| molecular formula | C184H282N50O60S |
|---|---|
| molecular weight | 4187 Da (PubChem) |
| computed backbone mass | 4187.61 Da |
| length | 39 residues |
| net charge (pH 7.4) | -3 |
| mean hydropathy | -0.69 |
| half-life | not characterised |
| delivery route | subcutaneous |
| PubChem CID | 45588096 |
| PDB | not characterised |
| UniProt parent | not characterised |
Mechanism
GLP-1 receptor agonist resistant to DPP-4 cleavage.
Reported targets: GLP-1R
Experimental structure
No experimental structure deposited in the PDB. A predicted fold is not a structure, so nothing is drawn.
Reported effects
Each row is an outcome described in the literature indexed for this peptide.
| reported outcome | where it appears |
|---|---|
| glycaemic control | Exendin-4 improves neurodevelopmental outcome after neonatal germinal matrix… Cell death & disease 2026 |
| weight loss | Exendin-4 as a multi-target therapy for Fetal Inflammatory Response Syndrome… Frontiers in neurology 2026 |
Registered trials
| NCT | title | status | phase |
|---|---|---|---|
| NCT01270191 | The Effects of Short-Term Exenatide Therapy in Newly Diagnosed Type 2 Diabetic Patients | UNKNOWN | PHASE4 |
| NCT06256419 | Association of Gene Polymorphism With Susceptibility to T2DM and the Therapeutic Responses t | RECRUITING | NA |
| NCT02584075 | Evaluate the Effect of Exenatide Treatment on Coronary Artery Endothelial Function | UNKNOWN | PHASE4 |
| NCT00917267 | A Study to Examine the Effects of Exenatide Once-Weekly Injection on Glucose Control and Saf | COMPLETED | PHASE3 |
| NCT01855490 | Study of the Acute Metabolic Effect of Exenatide in Type 1 Diabetes | COMPLETED | PHASE1 |
Literature (8)
Exendin-4 improves neurodevelopmental outcome after neonatal germinal matrix hemorrhage — Cell death & disease 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42618557 · DOI 10.1038/s41419-026-09189-9
Exendin-4 as a multi-target therapy for Fetal Inflammatory Response Syndrome-induced brain injury — Frontiers in neurology 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42661740 · DOI 10.3389/fneur.2026.1848474
M14 substitutions in exanatide modulate alpha-synuclein aggregation — The FEBS journal 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 41206637 · DOI 10.1111/febs.70321
Acute glucagon-like peptide-1 receptor agonist, semaglutide, attenuates cue-, drug-, and stress-induced fentanyl seeking in male Sprague-Dawley rats — Behavioural pharmacology 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42228850 · DOI 10.1097/fbp.0000000000000880
Exendin-4 improves high glucose-induced mitochondrial dysfunction of pancreatic β-cells via PKA/Drp1 signaling — The Journal of endocrinology 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42454501 · DOI 10.1530/joe-26-0023
The novel GLP-1/GIP dual receptor agonist DA5-CH is superior to tirzepatide and exendin-4 in the 6-OHDA Parkinson rat model — Frontiers in endocrinology 2026
IntroductionParkinson's disease (PD) is a progressive neurodegenerative disorder for which there is no cure. Diabetes is one of the risk factors for developing PD. Tirzepatide is a novel long-acting glucagon-like peptide-1 (GLP-1) and glucose-dependent insulinotropic polypeptide (GIP) receptor agonist that is on the market as a treatment for diabetes. Importantly, two phase II trials in PD patients showed good effects with the GLP-1 receptor agonists Exendin-4 and Lixisenatide.MethodsWe have developed a dual GLP-1/GIP receptor agonist (DA5-CH) that can cross the blood-brain barrier (BBB) at a higher rate than Tirzepatide. Here, we tested Exendin-4, Tirzepatide and DA5-CH in the 6-OHDA-lesion rat model of PD. The drug treatment was daily ([dose redacted], ip.) for 30 days.ResultsDA5-CH was more effective than Tirzepatide or Exendin-4. In the substantia nigra, dopaminergic neurons were protecte…
open access ↗ · PMID 42165019 · DOI 10.3389/fendo.2026.1825379
GLP-1R and GIPR crosstalk modulates insulinotropic signaling pathways — Cell chemical biology 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42419304 · DOI 10.1016/j.chembiol.2026.06.003
A glucose-responsive dual-nanoparticle-hydrogel-based microneedle patch for co-delivery of insulin and exendin-4 — Biomaterials science 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42148925 · DOI 10.1039/d6bm00181e
The mechanism, illustrated
Not memed yet.
33 of the 100 indexed peptides have one. See which →
Related
Semaglutide
incretin · 8 citations
Tirzepatide
incretin · 8 citations
Retatrutide
incretin · 8 citations
Liraglutide
incretin · 8 citations
GLP-1 (7-37)
incretin · 8 citations
GIP
incretin · 8 citations