biohacking$bioLLM CA: TBA

database / hormone

Galanin

research compound hormone nervousendocrine mass-verified
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
224 heavy atoms · 440 bonds · drag to pan, scroll to zoom C139O43N42

Skeletal structure drawn from the computed atomic coordinates in PubChem CID 16133823. Carbons are implicit vertices, hydrogens on carbon suppressed. Every atom sits where PubChem placed it.

Sequence

GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS

Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser

1. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G12. Trp — Tryptophan · aromatic · hydropathy -0.9 · charge 0W3. Thr — Threonine · polar · hydropathy -0.7 · charge 0T4. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L5. Asn — Asparagine · polar · hydropathy -3.5 · charge 0N6. Ser — Serine · polar · hydropathy -0.8 · charge 0S67. Ala — Alanine · hydrophobic · hydropathy 1.8 · charge 0A8. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G9. Tyr — Tyrosine · aromatic · hydropathy -1.3 · charge 0Y10. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L11. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L1112. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G13. Pro — Proline · proline · hydropathy -1.6 · charge 0P14. His — Histidine · positive · hydropathy -3.2 · charge 0H15. Ala — Alanine · hydrophobic · hydropathy 1.8 · charge 0A16. Val — Valine · hydrophobic · hydropathy 4.2 · charge 0V1617. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G18. Asn — Asparagine · polar · hydropathy -3.5 · charge 0N19. His — Histidine · positive · hydropathy -3.2 · charge 0H20. Arg — Arginine · positive · hydropathy -4.5 · charge +1R21. Ser — Serine · polar · hydropathy -0.8 · charge 0S2122. Phe — Phenylalanine · aromatic · hydropathy 2.8 · charge 0F23. Ser — Serine · polar · hydropathy -0.8 · charge 0S24. Asp — Aspartic acid · negative · hydropathy -3.5 · charge −1D25. Lys — Lysine · positive · hydropathy -3.9 · charge +1K26. Asn — Asparagine · polar · hydropathy -3.5 · charge 0N2627. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G28. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L29. Thr — Threonine · polar · hydropathy -0.7 · charge 0T30. Ser — Serine · polar · hydropathy -0.8 · charge 0S30

Computed backbone mass 3157.45 Da agrees with PubChem's reported 3157.4 Da (Δ 0.05 Da). Two independent sources agree on the primary structure.

Molecular data

Chemical fields come from the PubChem compound record; computed values are derived from the sequence shown above.
molecular formulaC139H210N42O43
molecular weight3157.4 Da (PubChem)
computed backbone mass3157.45 Da
length30 residues
net charge (pH 7.4)+1
mean hydropathy-0.45
half-lifenot characterised
delivery routenot characterised
PubChem CID16133823
PDBnot characterised
UniProt parentP22466

Mechanism

GAL1-3 receptor agonist; neuropeptide with roles in mood, feeding and nociception.

Reported targets: GALR1 GALR2 GALR3

Experimental structure

No experimental structure deposited in the PDB. A predicted fold is not a structure, so nothing is drawn.

Position in the parent protein

exact match at residues 33–62 of Galanin peptides (123 aa)

…LASLLLAAALSASAGLWSPAKEKRGWTLNSAGYLLGPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENNI…

Parent sequence from UniProt P22466. Cleaved from the galanin precursor.

Reported effects

Each row is an outcome described in the literature indexed for this peptide.

Reported observations and the corpus they are drawn from.
reported outcomewhere it appears
neuroprotection in modelsExploring the causal role and mechanism of galanin in glioblastoma: integrat… Frontiers in pharmacology 2026
feeding behaviour in modelsNeuropeptide Alterations in Type 2 Diabetes Mellitus: A Meta-Analysis of Cir… Endocrinology, diabetes & metabolism 2026

Literature (8)

Exploring the causal role and mechanism of galanin in glioblastoma: integration of mendelian randomization, network analysis, molecular docking and experimental validation — Frontiers in pharmacology 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42614515 · DOI 10.3389/fphar.2026.1916071

Neuropeptide Alterations in Type 2 Diabetes Mellitus: A Meta-Analysis of Circulating Spexin and Galanin Levels — Endocrinology, diabetes & metabolism 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42573161 · DOI 10.1002/edm2.70303

CSF galanin and noradrenaline downregulation by psilocybin therapy in major depressive disorder — Neuropsychopharmacology : official publication of the American College of Neuropsychopharmacology 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42414566 · DOI 10.1038/s41386-026-02490-3

Galanin Inhibits Histaminergic Neurons via Galanin Receptor 1 — eNeuro 2026

Galanin-expressing neurons in the ventrolateral preoptic area (VLPOgalanin) are active during sleep and play an important role in regulating non-rapid eye movement (NREM) sleep. It is generally believed that VLPOgalanin neurons promote sleep via inhibitory actions in arousal-promoting regions of the brain. Histaminergic neurons are a population of wake-active neurons that receive strong projections from the sleep-active VLPOgalanin neurons. However, the ability of galanin to influence the activity of histaminergic neurons has received limited attention. Here, using whole-cell patch-clamp electrophysiological recordings from genetically identified histaminergic neurons in male mice, we explore the mechanisms by which galanin influences histaminergic neuron electrical excitability. Our results reveal that galanin is a powerful inhibitor of histaminergic neuron activity and demonstrate that…

open access ↗ · PMID 41651655 · DOI 10.1523/eneuro.0420-25.2026

Intravenous galanin (1-16) and a GalR1 agonist attenuate allodynia in rats with spared nerve injury — Pain reports 2026

IntroductionChronic pain is a major unmet medical need, with current treatments often providing limited relief. The neuropeptide galanin, acting through GalR1-3 receptors, has been implicated in pain modulation. Although galanin analogues are typically administered intrathecally, emerging evidence suggests that peptides can cross the blood-brain barrier. We hypothesized that systemic administration of the biologically active fragment galanin (1-16) could attenuate neuropathic pain.ObjectivesTo evaluate whether intravenous galanin (1-16) reduces pain-like behaviors in a rat model of neuropathic pain and to compare its effects when using a selective GalR1 agonist.MethodsMale Sprague-Dawley rats underwent spared nerve injury. Animals received intravenous galanin (1-16), M617 (selective GalR1), or vehicle. Mechanical and cold allodynia were assessed using von Frey filaments and acetone testi…

open access ↗ · PMID 41822106 · DOI 10.1097/pr9.0000000000001422

Galanin receptor 2: A multifunctional modulator in neurological diseases - Structure, mechanisms, and therapeutic prospects — Neuropeptides 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42269375 · DOI 10.1016/j.npep.2026.102634

Galanin Receptors: G Protein-Dependent Signaling and Beyond — Biomolecules 2026

The G protein-coupled galanin receptors include three different subtypes: galanin receptor 1, 2 and 3 (GalR1, GalR2, GalR3). The neuropeptide galanin is the principal natural agonist of the galanin receptors, the so-called galaninergic system. Galanin-like peptide and spexin have also been identified as natural ligands of the galanin receptors. Galanin receptors are widely expressed in the brain; however, they can be found in other tissues, such as the skeletal muscle, the heart, and the gastrointestinal tract. The galaninergic system regulates diverse biological processes, including feeding behavior, neuroprotection, learning, memory, cardiovascular and renal function, and nociception. Its dysregulation is associated with various diseases, such as Alzheimer's disease, diabetes mellitus, epilepsy, depression, and cancer. The stimulation of GalR1 and GalR3 leads to the Gαi/o-type G protei…

open access ↗ · PMID 41750307 · DOI 10.3390/biom16020236

Rotational TBI causes neuronal stress and changes in the monoamine and galanin systems — Experimental neurology 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 41831549 · DOI 10.1016/j.expneurol.2026.115711

The mechanism, illustrated

Not memed yet.

33 of the 100 indexed peptides have one. See which →

Related

Glucagon

hormone · 8 citations

Ghrelin

hormone · 8 citations

Oxytocin

hormone · 8 citations

Vasopressin

hormone · 8 citations

Gonadorelin

hormone · 8 citations

Kisspeptin-10

hormone · 8 citations