biohacking$bioLLM CA: TBA

database / hormone

Dynorphin A (1-13)

research compound hormone nervous mass-verified
OOOOOOOOOOOOOOONNNNNNNNNNNNNNNNNNNNNNNNHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
114 heavy atoms · 242 bonds · drag to pan, scroll to zoom C75N24O15

Skeletal structure drawn from the computed atomic coordinates in PubChem CID 25075996. Carbons are implicit vertices, hydrogens on carbon suppressed. Every atom sits where PubChem placed it.

Sequence

YGGFLRRIRPKLK

Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys

1. Tyr — Tyrosine · aromatic · hydropathy -1.3 · charge 0Y12. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G3. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G4. Phe — Phenylalanine · aromatic · hydropathy 2.8 · charge 0F5. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L6. Arg — Arginine · positive · hydropathy -4.5 · charge +1R67. Arg — Arginine · positive · hydropathy -4.5 · charge +1R8. Ile — Isoleucine · hydrophobic · hydropathy 4.5 · charge 0I9. Arg — Arginine · positive · hydropathy -4.5 · charge +1R10. Pro — Proline · proline · hydropathy -1.6 · charge 0P11. Lys — Lysine · positive · hydropathy -3.9 · charge +1K1112. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L13. Lys — Lysine · positive · hydropathy -3.9 · charge +1K13

Computed backbone mass 1603.98 Da agrees with PubChem's reported 1604 Da (Δ 0.02 Da). Two independent sources agree on the primary structure.

Molecular data

Chemical fields come from the PubChem compound record; computed values are derived from the sequence shown above.
molecular formulaC75H126N24O15
molecular weight1604 Da (PubChem)
computed backbone mass1603.98 Da
length13 residues
net charge (pH 7.4)+5
mean hydropathy-0.78
half-lifenot characterised
delivery routenot characterised
PubChem CID25075996
PDBnot characterised
UniProt parentP01213

Mechanism

Kappa-opioid receptor agonist.

Reported targets: KOR

Experimental structure

No experimental structure deposited in the PDB. A predicted fold is not a structure, so nothing is drawn.

Position in the parent protein

exact match at residues 207–219 of Proenkephalin-B (254 aa)

…PKRSSEVAGEGDGDSMGHEDLYKRYGGFLRRIRPKLKWDNQKRYGGFLRRQFKVVTRSQED…

Parent sequence from UniProt P01213. Cleaved from prodynorphin.

Reported effects

Each row is an outcome described in the literature indexed for this peptide.

Reported observations and the corpus they are drawn from.
reported outcomewhere it appears
analgesic signallingMetabolic syndrome reduces but does not eliminate the cardioprotective effec… Pflugers Archiv : European journal of physiology 2025
stress-response modulation in modelsDiscovery of a pyridine-piperazine-based small molecule that enhances the ac… The Journal of pharmacology and experimental therapeutics 2026

Literature (5)

Metabolic syndrome reduces but does not eliminate the cardioprotective effect of adaptation to hypoxia: the link with changes in the opioid system — Pflugers Archiv : European journal of physiology 2025

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 41354854 · DOI 10.1007/s00424-025-03144-x

Discovery of a pyridine-piperazine-based small molecule that enhances the activity of peptidase neurolysin — The Journal of pharmacology and experimental therapeutics 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 41759240 · DOI 10.1016/j.jpet.2026.103827

Structural basis of divergent substrate recognition and inhibition of human neurolysin — Scientific reports 2024

A zinc metallopeptidase neurolysin (Nln) processes diverse bioactive peptides to regulate signaling in the mammalian nervous system. To understand how Nln interacts with various peptides with dissimilar sequences, we determined crystal structures of Nln in complex with diverse peptides including dynorphins, angiotensin, neurotensin, and bradykinin. The structures show that Nln binds these peptides in a large dumbbell-shaped interior cavity constricted at the active site, making minimal structural changes to accommodate different peptide sequences. The structures also show that Nln readily binds similar peptides with distinct registers, which can determine whether the peptide serves as a substrate or a competitive inhibitor. We analyzed the activities and binding of Nln toward various forms of dynorphin A peptides, which highlights the promiscuous nature of peptide binding and shows how d…

open access ↗ · PMID 39117724 · DOI 10.1038/s41598-024-67639-w

Effects of Opioid Peptides on Changes in Lipid Metabolism in Rats Subjected to Swimming Stress — Bulletin of experimental biology and medicine 2017

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 28091903 · DOI 10.1007/s10517-017-3603-7

Purification and Biochemical Characterization of TsMS 3 and TsMS 4: Neuropeptide-Degrading Metallopeptidases in the <i>Tityus serrulatus</i> Venom — Toxins 2019

Although omics studies have indicated presence of proteases on the Tityus serrulatus venom (TsV), little is known about the function of these molecules. The TsV contains metalloproteases that cleave a series of human neuropeptides, including the dynorphin A (1-13) and the members of neuropeptide Y family. Aiming to isolate the proteases responsible for this activity, the metalloserrulase 3 and 4 (TsMS 3 and TsMS 4) were purified after two chromatographic steps and identified by mass spectrometry analysis. The biochemical parameters (pH, temperature and cation effects) were determined for both proteases, and the catalytic parameters (Km, kcat, cleavage sites) of TsMS 4 over fluorescent substrate were obtained. The metalloserrulases have a high preference for cleaving neuropeptides but presented different primary specificities. For example, the Leu-enkephalin released from dynorphin A (1-1…

open access ↗ · PMID 30935107 · DOI 10.3390/toxins11040194

The mechanism, illustrated

Not memed yet.

33 of the 100 indexed peptides have one. See which →

Related

Glucagon

hormone · 8 citations

Ghrelin

hormone · 8 citations

Oxytocin

hormone · 8 citations

Vasopressin

hormone · 8 citations

Gonadorelin

hormone · 8 citations

Kisspeptin-10

hormone · 8 citations