biohacking$bioLLM CA: TBA

database / hormone

Atrial natriuretic peptide

also known as ANP, atrial natriuretic factor

research compound hormone cardiovascularrenal modified — mass check n/a
SSSOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
214 heavy atoms · 420 bonds · drag to pan, scroll to zoom C127N45O39S3

Skeletal structure drawn from the computed atomic coordinates in PubChem CID 16129708. Carbons are implicit vertices, hydrogens on carbon suppressed. Every atom sits where PubChem placed it.

Sequence

SLRRSSCFGGRMDRIGAQSGLGCNSFRY

Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr

1. Ser — Serine · polar · hydropathy -0.8 · charge 0S12. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L3. Arg — Arginine · positive · hydropathy -4.5 · charge +1R4. Arg — Arginine · positive · hydropathy -4.5 · charge +1R5. Ser — Serine · polar · hydropathy -0.8 · charge 0S6. Ser — Serine · polar · hydropathy -0.8 · charge 0S67. Cys — Cysteine · cysteine · hydropathy 2.5 · charge 0C8. Phe — Phenylalanine · aromatic · hydropathy 2.8 · charge 0F9. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G10. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G11. Arg — Arginine · positive · hydropathy -4.5 · charge +1R1112. Met — Methionine · hydrophobic · hydropathy 1.9 · charge 0M13. Asp — Aspartic acid · negative · hydropathy -3.5 · charge −1D14. Arg — Arginine · positive · hydropathy -4.5 · charge +1R15. Ile — Isoleucine · hydrophobic · hydropathy 4.5 · charge 0I16. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G1617. Ala — Alanine · hydrophobic · hydropathy 1.8 · charge 0A18. Gln — Glutamine · polar · hydropathy -3.5 · charge 0Q19. Ser — Serine · polar · hydropathy -0.8 · charge 0S20. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G21. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L2122. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G23. Cys — Cysteine · cysteine · hydropathy 2.5 · charge 0C24. Asn — Asparagine · polar · hydropathy -3.5 · charge 0N25. Ser — Serine · polar · hydropathy -0.8 · charge 0S26. Phe — Phenylalanine · aromatic · hydropathy 2.8 · charge 0F2627. Arg — Arginine · positive · hydropathy -4.5 · charge +1R28. Tyr — Tyrosine · aromatic · hydropathy -1.3 · charge 0Y28

Modified molecule. A Cys7–Cys23 disulfide forms the 17-residue ring required for activity.

Backbone carries modifications, so computed backbone mass is not comparable to the reported mass of the complete molecule.

Molecular data

Chemical fields come from the PubChem compound record; computed values are derived from the sequence shown above.
molecular formulaC127H203N45O39S3
molecular weight3080.5 Da (PubChem)
computed backbone mass3082.48 Da
length28 residues
net charge (pH 7.4)+4
mean hydropathy-0.5
half-lifenot characterised
delivery routenot characterised
PubChem CID16129708
PDBnot characterised
UniProt parentP01160

Mechanism

NPR-A agonist; raises cGMP, promoting natriuresis and vasodilation.

Reported targets: NPR-A

Experimental structure

No experimental structure deposited in the PDB. A predicted fold is not a structure, so nothing is drawn.

Position in the parent protein

exact match at residues 124–151 of Natriuretic peptides A (151 aa)

…GPWDSSDRSALLKSKLRALLTAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY

Parent sequence from UniProt P01160. Cleaved from the ANP precursor.

Reported effects

Each row is an outcome described in the literature indexed for this peptide.

Reported observations and the corpus they are drawn from.
reported outcomewhere it appears
natriuresisAtrial Natriuretic Peptide Limits Oxidative Injury in Experimental Acute Pan… Research Square 2026
vasodilationReduced Left Atrial Reservoir Strain Is Associated with Histopathologically … Journal of the American Society of Echocardiography : official publication of the American Society of Echocardiography 2026
blood-pressure effectsCarperitide National Institute of Child Health and Human Development, Bethesda (MD) 2006

Registered trials

Records from ClinicalTrials.gov. Listed for reference — this project sponsors no trial and is not involved in any of them.
NCTtitlestatusphase
NCT07532317Comparison of Myval THV Series With Guideline-Directed Medical Therapy in Participants With NOT_YET_RECRUITINGNA
NCT06009185Safety and Efficacy of BIA 5-1058 in PAHCOMPLETEDPHASE2
NCT05636176A Research Study to Look at How Ziltivekimab Works Compared to Placebo in People With Heart ACTIVE_NOT_RECRUITINGPHASE3
NCT00213785A Study of Plasmatic Concentrations of Endothelin-1 (ET1), Atrial Natriuretic Peptide (ANP) COMPLETED
NCT06668389Sodium-Glucose Cotransporter 2 Inhibitors for Repaired Tetralogy of Fallot Patients for EnhaRECRUITINGPHASE4

Literature (8)

Atrial Natriuretic Peptide Limits Oxidative Injury in Experimental Acute Pancreatitis Through Activation of Antioxidant Pathways — Research Square 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · DOI 10.21203/rs.3.rs-10516071/v1

Reduced Left Atrial Reservoir Strain Is Associated with Histopathologically Confirmed Atrial Natriuretic Peptide-Amyloid Deposition — Journal of the American Society of Echocardiography : official publication of the American Society of Echocardiography 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42082035 · DOI 10.1016/j.echo.2026.04.014

Carperitide — National Institute of Child Health and Human Development, Bethesda (MD) 2006

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42475463

Measurement of Atrial Natriuretic Peptide (ANP) Concentrations in Human Breast Milk and Maternal Plasma During Carperitide Therapy (Two Case Reports) — Journal of human lactation : official journal of International Lactation Consultant Association 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42311077 · DOI 10.1177/08903344261451984

Atrial natriuretic peptide can be biomarker for predicting atrial fibrillation in embolic stroke of undetermined source — Neurological sciences : official journal of the Italian Neurological Society and of the Italian Society of Clinical Neurophysiology 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42303893 · DOI 10.1007/s10072-026-09180-4

Content of Atrial Natriuretic Peptide in Cardiomyocytes Granules of Newborn Female Rats with Type 1 Diabetes Mellitus — Bulletin of experimental biology and medicine 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 41944942 · DOI 10.1007/s10517-026-06643-8

Plasma Atrial Natriuretic Peptide Concentrations and Associated Factors in Captive Dolphins: Potential Implications for Cardiovascular Assessment — Animals : an open access journal from MDPI 2026

This exploratory study evaluated plasma atrial natriuretic peptide (ANP) concentrations in four species of captive cetaceans and their associations with physiological and environmental factors, including husbandry conditions, diet, and management practices. Twenty-six individuals were voluntarily sampled, and blood samples were analyzed using a human-based chemiluminescent immunoassay. Transthoracic echocardiography was also attempted in several individuals but was technically challenging due to interference from the lung tissue and the sternum. The mean plasma ANP concentration in clinically healthy young animals was 44.12 ± 14.62 pg/mL, with no significant differences observed according to age, sex, species, or the presence of mild chronic disease. ANP was detectable across all species using human reagents. In addition, brain natriuretic peptide (BNP), a commonly used cardiac biomarker…

open access ↗ · PMID 42071920 · DOI 10.3390/ani16081151

Carboxy-terminal 24-amino-acid peptide of integral membrane protein 2A is produced in the heart and stimulates atrial natriuretic peptide release — Scientific reports 2026

Humoral factors regulating cardiac myocytes have not yet been fully elucidated. Using mass spectrometry, we analyzed peptides released from primary neonatal rat cardiac fibroblasts to identify a 24-amino-acid peptide with an intramolecular disulfide bond. It is derived from the C-terminal end of integral membrane protein 2A (ITM2A), a single-pass type II membrane protein; the peptide sequence is identical between humans and rodents and N-terminally flanked by conserved dibasic residues KR. The ITM2A peptide stimulated secretion of atrial natriuretic peptide (ANP), the predominant hormone produced by cardiac myocytes, in a Langendorff rat heart perfusion system as well as a primary culture of neonatal rat ventricular myocytes. These ANP secretion changes were not accompanied by an alteration in the beating rate, a key determinant of ANP secretion. In a mouse cardiac infarction model, both…

open access ↗ · PMID 41839968 · DOI 10.1038/s41598-026-43576-8

The mechanism, illustrated

Not memed yet.

33 of the 100 indexed peptides have one. See which →

Related

Glucagon

hormone · 8 citations

Ghrelin

hormone · 8 citations

Oxytocin

hormone · 8 citations

Vasopressin

hormone · 8 citations

Gonadorelin

hormone · 8 citations

Kisspeptin-10

hormone · 8 citations