database / metabolic
Teduglutide
also known as GLP-2 analogue, Gattex
Skeletal structure drawn from the computed atomic coordinates in PubChem CID 16139605. Carbons are implicit vertices, hydrogens on carbon suppressed. Every atom sits where PubChem placed it.
Sequence
HGDGSFSDEMNTILDNLAARDFINWLIQTKITD
His-Gly-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp
- hydrophobic
- positive
- negative
- polar
- aromatic
- glycine
- proline
- cysteine
Computed backbone mass 3752.13 Da agrees with PubChem's reported 3752.1 Da (Δ 0.03 Da). Two independent sources agree on the primary structure.
Molecular data
| molecular formula | C164H252N44O55S |
|---|---|
| molecular weight | 3752.1 Da (PubChem) |
| computed backbone mass | 3752.13 Da |
| length | 33 residues |
| net charge (pH 7.4) | -4 |
| mean hydropathy | -0.35 |
| half-life | not characterised |
| delivery route | subcutaneous |
| PubChem CID | 16139605 |
| PDB | not characterised |
| UniProt parent | not characterised |
Mechanism
GLP-2 receptor agonist; Gly2 substitution confers DPP-4 resistance.
Reported targets: GLP-2R
Experimental structure
No experimental structure deposited in the PDB. A predicted fold is not a structure, so nothing is drawn.
Reported effects
Each row is an outcome described in the literature indexed for this peptide.
| reported outcome | where it appears |
|---|---|
| intestinal mucosal growth | Optimizing teduglutide treatment regimens in children with short bowel syndr… Frontiers in pediatrics 2026 |
| nutrient absorption | Effectiveness and Safety of Teduglutide Treatment in Adult Patients with Sho… Journal of clinical medicine 2026 |
Registered trials
| NCT | title | status | phase |
|---|---|---|---|
| NCT00819468 | Pharmacokinetics (PK) of [dose redacted] Teduglutide in Participants With Moderately Impaire | COMPLETED | PHASE1 |
| NCT01952080 | A Pharmacokinetic, Safety, and Pharmacodynamic Study of Teduglutide in Pediatric Subjects Wi | COMPLETED | PHASE3 |
| NCT03953170 | Pilot Study to Investigate the Effect of Teduglutide on Temporary Ileostomy Function and Com | WITHDRAWN | PHASE3 |
| NCT03442972 | Glucagon-like Peptide-2 Mediated Secretion of Stored Enteral Lipids | COMPLETED | PHASE2, PHASE3 |
| NCT06973304 | A Study of Teduglutide in Chinese Adults With Short Bowel Syndrome | RECRUITING | PHASE3 |
Literature (8)
Optimizing teduglutide treatment regimens in children with short bowel syndrome — Frontiers in pediatrics 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42591359 · DOI 10.3389/fped.2026.1898958
Effectiveness and Safety of Teduglutide Treatment in Adult Patients with Short Bowel Syndrome: A Case Series and Review of Current Evidence — Journal of clinical medicine 2026
Background: Short bowel syndrome (SBS) is the leading cause of chronic intestinal failure and is frequently associated with long-term dependence on parenteral nutrition (PN) and intravenous fluids. Teduglutide, a glucagon-like peptide-2 (GLP-2) analogue, promotes intestinal adaptation and has been demonstrated to reduce parenteral support requirements. However, real-world data from the Greek population are scarce. Methods: We conducted a non-interventional, multicenter, retrospective cohort study across 5 centers in Greece, including adult patients with SBS receiving teduglutide therapy. Demographic and clinical characteristics, parenteral nutrition and intravenous fluid requirements, body mass index (BMI), laboratory parameters, and adverse events were recorded at baseline and during follow-up at weeks 4, 12, 26, and 52. Results: Eight adult patients with SBS were included (75% female),…
open access ↗ · PMID 41827448 · DOI 10.3390/jcm15052033
[Use of teduglutide in short bowel syndrome in infants, children and adolescents: Position paper of the working group "Chronic intestinal failure" of the Society for Paediatric Gastroenterology and Nutrition (GPGE)] — Zeitschrift fur Gastroenterologie 2026
AbstractPaediatric short bowel syndrome (SBS) with chronic intestinal failure (IF) is a rare, complex and potentially life-threatening condition. The main causes in children are necrotizing enterocolitis, volvulus, congenital malformations, and other enteropathies. The resulting reduced intestinal absorption capacity often requires parenteral nutrition (PN), which is associated with complications such as catheter infections, liver disease, and thrombosis, as well as significant limitations in quality of life. The goal of multidisciplinary treatment is to achieve enteral autonomy, prevent complications, and improve quality of life. With the introduction of the glucagon-like peptide-2 analogue (GLP-2-analogue) teduglutide, an additional therapeutic option is available that can improve fluid and nutrient absorption and reduce the need for parenteral support, up to partial or complete weanin…
open access ↗ · PMID 41672430 · DOI 10.1055/a-2757-3525
Delayed presentation of a retained colonic segment in a child with intestinal failure on teduglutide — JPGN reports 2025
Teduglutide is a glucagon-like peptide 2 (GLP-2) analogue that was approved by the United States Food and Drug Administration for the treatment of pediatric (>1 year) intestinal failure due to short bowel syndrome in 2019. GLP-2 analogues promote rapid intestinal adaptation, increasing the absorptive capacity of residual intestine after surgical resection to aid the achievement of enteral autonomy or reduce parenteral nutrition requirements. Despite relatively few reported side effects, there is a theoretical risk of proliferative complications. Here we present an intriguing case of a pediatric patient found to have a decade-long retained, discontinuous segment of colon from a surgical procedure performed in infancy, which became clinically significant after a period of treatment with teduglutide.
open access ↗ · PMID 41245050 · DOI 10.1002/jpr3.70049
Efficacy of Teduglutide in Pediatric Short Bowel Syndrome: Association with Citrulline Levels and Anatomical Location of Remnant Small Intestine — Children (Basel, Switzerland) 2025
Background/Objectives: Short bowel syndrome (SBS) is the leading cause of pediatric intestinal failure. Plasma citrulline is considered a marker indicating an enterocyte volume and may help evaluate the response to teduglutide; however, this interpretation may vary depending on the remnant bowel anatomy. Methods: We conducted a retrospective case series of four pediatric patients with SBS (aged Results: This study included two males and two females. All patients showed an increase in plasma citrulline levels and a reduction in the requirement for parenteral nutrition (PN) after 12 months of teduglutide treatment. In SBS type 2 (jejunocolic anastomosis), citrulline levels increased by 114% and 52%, with PN reduction rates of 100% and 30%, respectively. In SBS type 3 (jejunoileal anastomosis), citrulline levels increased by 13.6% and 34%, with PN reductions of 33% and 73%, respectively. Co…
open access ↗ · PMID 40868429 · DOI 10.3390/children12080977
Efficacy and safety of teduglutide in children with short bowel syndrome: a narrative review — Pediatric surgery international 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42622692 · DOI 10.1007/s00383-026-06474-8
Assessing the health-related quality of life and clinical effect in children with short bowel syndrome receiving teduglutide treatment — BMC pediatrics 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42410547 · DOI 10.1186/s12887-026-07283-7
Development of Teduglutide purity certified reference material (GBW09342) through amino acid-based isotope dilution mass spectrometry and sulfur-based isotope dilution inductively coupled plasma mass spectrometry — Talanta 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42385596 · DOI 10.1016/j.talanta.2026.130223
The mechanism, illustrated
Not memed yet.
33 of the 100 indexed peptides have one. See which →
Related
Pramlintide
metabolic · 8 citations
Leptin fragment (116-130)
metabolic · 6 citations
AOD-9604
metabolic · 8 citations
HGH Fragment 176-191
metabolic · 2 citations
Linaclotide
metabolic · 8 citations
Cagrilintide
metabolic · 8 citations