biohacking$bioLLM CA: TBA

database / healing

TB-500

also known as thymosin β4 fragment (17-23)

preclinical healing musculoskeletalcardiovascularintegumentary modified — mass check n/a
OOOOOOOOOOOOOONNNNNNNNNNHHHHHHHHHHHHHHHHH
62 heavy atoms · 129 bonds · drag to pan, scroll to zoom C38O14N10

Skeletal structure drawn from the computed atomic coordinates in PubChem CID 62707662. Carbons are implicit vertices, hydrogens on carbon suppressed. Every atom sits where PubChem placed it.

Sequence

LKKTETQ

Leu-Lys-Lys-Thr-Glu-Thr-Gln

1. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L12. Lys — Lysine · positive · hydropathy -3.9 · charge +1K3. Lys — Lysine · positive · hydropathy -3.9 · charge +1K4. Thr — Threonine · polar · hydropathy -0.7 · charge 0T5. Glu — Glutamic acid · negative · hydropathy -3.5 · charge −1E6. Thr — Threonine · polar · hydropathy -0.7 · charge 0T67. Gln — Glutamine · polar · hydropathy -3.5 · charge 0Q7

Modified molecule. N-terminally acetylated. The build-time mass check flagged this: the bare LKKTETQ backbone computes to 847.0 Da against PubChem's 889.0 Da — a difference of exactly 42.0 Da, the mass of an acetyl group. The sequence is right; the molecule carries an N-terminal acetyl.

Backbone carries modifications, so computed backbone mass is not comparable to the reported mass of the complete molecule.

Molecular data

Chemical fields come from the PubChem compound record; computed values are derived from the sequence shown above.
molecular formulaC38H68N10O14
molecular weight889 Da (PubChem)
computed backbone mass846.98 Da
length7 residues
net charge (pH 7.4)+1
mean hydropathy-1.77
half-lifenot characterised
delivery routenot characterised
PubChem CID62707662
PDBnot characterised
UniProt parentP62328

Mechanism

Actin-binding fragment of thymosin β4; the LKKTETQ motif is the actin-binding region described in the literature.

Reported targets: G-actin

Experimental structure

No experimental structure deposited in the PDB. A predicted fold is not a structure, so nothing is drawn.

Position in the parent protein

exact match at residues 18–24 of Thymosin beta-4 (44 aa)

MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES

Parent sequence from UniProt P62328. TB-500 corresponds to the actin-binding fragment of thymosin β4.

Reported effects

Each row is an outcome described in the literature indexed for this peptide.

Reported observations and the corpus they are drawn from.
reported outcomewhere it appears
tissue repairEffects of BPC-157 and TB-500 on Achilles tendon healing in rats: A histopat… Joint diseases and related surgery 2026
cell migrationThymosin Beta-4 and TB-500 in Tissue Healing, Regeneration, and Musculoskele… Preprints.org 2026
angiogenesisPeptide Supplements and Their Therapeutic Applications in Sports Medicine The American journal of sports medicine 2026

Registered trials

Records from ClinicalTrials.gov. Listed for reference — this project sponsors no trial and is not involved in any of them.
NCTtitlestatusphase
NCT07487363TB-500 (Thymosin Beta 4 17-23 Fragment) for Cardiovascular Biomarkers in Stable ASCVDRECRUITINGPHASE1, PHASE2

Literature (8)

Effects of BPC-157 and TB-500 on Achilles tendon healing in rats: A histopathological and biomechanical study — Joint diseases and related surgery 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42542926 · DOI 10.52312/jdrs.2026.2951

Thymosin Beta-4 and TB-500 in Tissue Healing, Regeneration, and Musculoskeletal Repair: A Scoping Review — Preprints.org 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · DOI 10.20944/preprints202605.1124.v1

Peptide Supplements and Their Therapeutic Applications in Sports Medicine — The American journal of sports medicine 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42578445 · DOI 10.1177/03635465261464420

Therapeutic peptides in gerontology: mechanisms and applications for healthy aging — Frontiers in aging 2026

BackgroundPeptide therapeutics represent an emerging frontier in gerontological medicine, targeting fundamental hallmarks of aging including metabolic dysfunction, telomere attrition, tissue repair impairment, and hormonal decline.ObjectiveTo comprehensively review the mechanisms, clinical applications, evidence base, and safety profiles of therapeutic peptides with demonstrated or potential applications in healthy aging and age-related conditions.MethodsA comprehensive narrative review was conducted through systematic searches of PubMed, Scopus, and regulatory databases (FDA, WADA) from inception through January 2026. Search terms included "peptide therapeutics," "aging," "gerontology," "healthspan," combined with specific peptide names (tirzepatide, epitalon, GHK-Cu, BPC-157, TB-500, Semax, CJC-1295, ipamorelin, bremelanotide). Peer-reviewed articles, clinical trials, regulatory docume…

open access ↗ · PMID 42021992 · DOI 10.3389/fragi.2026.1790247

Simultaneous quantification of TB-500 and its metabolites in in-vitro experiments and rats by UHPLC-Q-Exactive orbitrap MS/MS and their screening by wound healing activities in-vitro — Journal of chromatography. B, Analytical technologies in the biomedical and life sciences 2024

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 38382158 · DOI 10.1016/j.jchromb.2024.124033

Peptides in Regenerative Medicine: A Comprehensive Review of Clinical Applications in Tissue Repair and Chronic Pain Management — Current pain and headache reports 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42635865 · DOI 10.1007/s11916-026-01542-z

Comparative effects of dietary sodium butyrate and tributyrin on broiler chickens' performance, gene expression, intestinal histomorphometry, blood indices, and litter — Scientific reports 2025

Sodium butyrate and tributyrin are known to enhance broiler chicken performance. In this study, 1,000 Arbor Acres broiler chicks were assigned to four dietary treatments (250 birds each; six replicates of 40-42 birds): a control basal diet (CON), or the same diet supplemented with either 500 g/ton tributyrin (40%) + copper + essential oils (TB-500), 300 g/ton di- and tri-butyrin (60%) (TB-300), or 500 g/ton coated sodium butyrate (40%) (SB-500). Weekly growth parameters were recorded, and on Day 35, carcass traits, serum biochemistry, immunity, gene expression (mTOR, TLR4, NBN), intestinal morphology, caecal microbiota, and litter hygiene were assessed. TB-300 improved body weight (+ 4.6%, P = 0.014), FCR (- 5.2%, P = 0.032), and European Production Efficiency Factor (EPEF) (+ 14.9%, P = 0.006). SB-500 significantly reduced litter Clostridia (P < 0.0001) and aerobic bacteria (P = 0.026) …

open access ↗ · PMID 40681595 · DOI 10.1038/s41598-025-09278-3

Injectable Peptide Therapy: A Primer for Orthopaedic and Sports Medicine Physicians — The American journal of sports medicine 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 41476424 · DOI 10.1177/03635465251357593

The mechanism, illustrated

Not memed yet.

33 of the 100 indexed peptides have one. See which →

Related

BPC-157

healing · 8 citations

Thymosin β4

healing · 8 citations

GHK

healing · 8 citations

Larazotide

healing · 3 citations