database / gh-secretagogue
Sermorelin
also known as GRF (1-29)
Skeletal structure drawn from the computed atomic coordinates in PubChem CID 16132413. Carbons are implicit vertices, hydrogens on carbon suppressed. Every atom sits where PubChem placed it.
Sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSR
Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg
- hydrophobic
- positive
- negative
- polar
- aromatic
- glycine
- proline
- cysteine
Modified molecule. C-terminal amide.
Backbone carries modifications, so computed backbone mass is not comparable to the reported mass of the complete molecule.
Molecular data
| molecular formula | C149H246N44O42S |
|---|---|
| molecular weight | 3357.9 Da (PubChem) |
| computed backbone mass | 3358.91 Da |
| length | 29 residues |
| net charge (pH 7.4) | +3 |
| mean hydropathy | -0.22 |
| half-life | not characterised |
| delivery route | subcutaneous |
| PubChem CID | 16132413 |
| PDB | not characterised |
| UniProt parent | P01286 |
Mechanism
The N-terminal 29 residues of GHRH — the shortest fully active fragment.
Reported targets: GHRHR
Experimental structure
No experimental structure deposited in the PDB. A predicted fold is not a structure, so nothing is drawn.
Helical wheel
Residues projected at 100° per turn, the standard α-helix rotation. Shown because helicity in this peptide is described in the cited literature.
Position in the parent protein
…FVILTLSNSSHCSPPPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARLGRQVDSMWA…
Parent sequence from UniProt P01286. Residues 1-29 of GHRH.
Reported effects
Each row is an outcome described in the literature indexed for this peptide.
| reported outcome | where it appears |
|---|---|
| GH release | Cationic exchange SPE combined with triple quadrupole UHPLC-MS/MS for detect… Analytical biochemistry 2023 |
| IGF-1 elevation | Analysis of growth hormone releasing hormone and its analogs in urine using … Journal of pharmaceutical and biomedical analysis 2026 |
Registered trials
| NCT | title | status | phase |
|---|---|---|---|
| NCT01237041 | Free Fatty Acids, Body Weight, and Growth Hormones Secretion in Children | TERMINATED | PHASE1, PHASE2 |
| NCT01264497 | Safety Study of TH9507 in Subjects With Stable, Type 2 Diabetes | COMPLETED | PHASE2 |
| NCT03226821 | Body Composition and Adipose Tissue in HIV | TERMINATED | PHASE4 |
| NCT00507104 | Pituitary Functions After Traumatic Brain Injury (TBI) and/or Subarachnoid Hemorrhage (SAH) | COMPLETED | — |
| NCT01632592 | Abdominal Obesity, Cardiovascular Inflammation, and Effects of Growth Hormone Releasing Horm | WITHDRAWN | NA |
Literature (8)
Cationic exchange SPE combined with triple quadrupole UHPLC-MS/MS for detection of GHRHs in urine samples — Analytical biochemistry 2023
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 37806509 · DOI 10.1016/j.ab.2023.115336
Analysis of growth hormone releasing hormone and its analogs in urine using nano liquid chromatography coupled with quadrupole/orbitrap mass spectrometry — Journal of pharmaceutical and biomedical analysis 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 41138283 · DOI 10.1016/j.jpba.2025.117207
Anterior cervical osteophyte-related dysphagia in a long-term growth hormone user: a case report — Frontiers in surgery 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42465868 · DOI 10.3389/fsurg.2026.1859548
Therapeutic Peptides in Orthopaedics: Applications, Challenges, and Future Directions — Journal of the American Academy of Orthopaedic Surgeons. Global research & reviews 2026
Therapeutic peptides are emerging as promising adjuncts in the management of orthopaedic injuries, grounded in their ability to modulate molecular signaling networks central to cellular medicine. By acting on key pathways such as PI3K/Akt, mTOR, MAPK, TGF-β, and AMPK, peptides exert influence over tissue regeneration, inflammation resolution, and neuromuscular recovery. Wound-healing peptides such as BPC-157, TB-500, and GHK-Cu promote angiogenesis, integrin-mediated extracellular matrix remodeling, and fibroblast activation, whereas growth hormone secretagogues like ipamorelin, CJC-1295, tesamorelin, sermorelin, and AOD-9604 activate IGF-1 signaling and satellite cell repair. Recovery-enhancing agents such as epithalon, delta sleep-inducing peptide, and pinealon target circadian and mitochondrial regulators, and neuroactive peptides like selank, semax, and dihexa enhance brain-derived n…
open access ↗ · PMID 41490200 · DOI 10.5435/jaaosglobal-d-25-00236
Safety and Efficacy of Approved and Unapproved Peptide Therapies for Musculoskeletal Injuries and Athletic Performance — Preprints.org 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · DOI 10.20944/preprints202512.1011.v3
Safety and Efficacy of Approved and Unapproved Peptide Therapies for Musculoskeletal Injuries and Athletic Performance — Sports medicine (Auckland, N.Z.) 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 41966639 · DOI 10.1007/s40279-026-02437-0
In-house standards derived from doping peptides: Enzymatic and serum stability and degradation profile of GHRP and GHRH-related peptides — Biomedical chromatography : BMC 2023
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 37688464 · DOI 10.1002/bmc.5741
Evaluation of Research Grade Peptides Marketed Directly to Consumers Reveals Extensive Variability in Purity and Measured Abundance — Preprints.org 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · DOI 10.20944/preprints202604.1748.v1
The mechanism, illustrated
Not memed yet.
33 of the 100 indexed peptides have one. See which →
Related
Ipamorelin
gh-secretagogue · 8 citations
CJC-1295
gh-secretagogue · 8 citations
Tesamorelin
gh-secretagogue · 8 citations
GHRP-2
gh-secretagogue · 8 citations
GHRP-6
gh-secretagogue · 7 citations
Hexarelin
gh-secretagogue · 8 citations